PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 251aa    MW: 28137.4 Da    PI: 9.1191
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047290genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.5e-33109167159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDg++WrKYGqK vk+s+fprsYYrCt+++C vkk+vers +d+++v++tYeg H+h+
  PGSC0003DMP400047290 109 LDDGFRWRKYGQKAVKNSPFPRSYYRCTTSSCGVKKRVERSIQDTSIVVTTYEGVHTHP 167
                           59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-3394169IPR003657WRKY domain
SuperFamilySSF1182905.49E-29101169IPR003657WRKY domain
PROSITE profilePS5081130.446104169IPR003657WRKY domain
SMARTSM007742.6E-38109168IPR003657WRKY domain
PfamPF031063.6E-26110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MFGVDEHQDC YNTTTSSIFD LLMFPSQQQR FITCSSLPES SSILSDHLIS NVVPVIPNLS  60
SISSSSTELP AHEDHQHKYK KQLKPNKKKQ KGKKEPRFAF MTKSEVDHLD DGFRWRKYGQ  120
KAVKNSPFPR SYYRCTTSSC GVKKRVERSI QDTSIVVTTY EGVHTHPCPL TPRGWVGVQP  180
VTTTYGGRVG GGDSGGRSHY GDYSSSLFST NNSLQEKRFW NSSNSSLAKD DHGLLQDMVS  240
SRMRSDLIEE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2899169777Probable WRKY transcription factor 4
2lex_A8e-2899169777Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191GGRVGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-173HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755171e-173HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355755.10.0PREDICTED: probable WRKY transcription factor 48 isoform X2
SwissprotO229001e-47WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLM1CLH80.0M1CLH8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000699660.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.19e-45WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]